(data stored in ACNUC1104 zone)

EMBL: CP000509.PE70

CP000509.PE70        Location/Qualifiers
FT   CDS             83161..83565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79620"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT5"
FT                   /protein_id="ABL79620.1"
FT                   /translation="MSGAVPTDPGTAADRAAIRRLLESHLESWNRGDLDALLDTYLQDE
FT                   SVRYASARTVIHGIERVRERFREAYPDRSRLGELRYEGLEIALAGRADAVVFGRARISR
FT                   EGLEDSVSLFSLHLFKRGGQWWIAADHTSA"
     MSGAVPTDPG TAADRAAIRR LLESHLESWN RGDLDALLDT YLQDESVRYA SARTVIHGIE        60
     RVRERFREAY PDRSRLGELR YEGLEIALAG RADAVVFGRA RISREGLEDS VSLFSLHLFK       120
     RGGQWWIAAD HTSA                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page