(data stored in ACNUC1104 zone)

EMBL: CP000509.PE71

CP000509.PE71        Location/Qualifiers
FT   CDS             83670..84680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0075"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: cgb:cg1413 secreted sugar-binding protein; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79621"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT6"
FT                   /protein_id="ABL79621.1"
FT                   /translation="MHKIVRAAAVGVALSSALFLSACSDTAETADAGSTSDESLSIGFF
FT                   GFSKTNSFAQAAFAGISEYAEANDATAEFTDPNFDVQVQLQQLKDALTSKRFDVWIVQA
FT                   NDGVAVQQTIQEAVDAGITVVAEFTPIGPDFETLKPQIPGTLSLVDDPKRNGTVLGELS
FT                   IDACADAGADPCEVAYLQGFSAQPIDVVRTDAFLAAVDRPGVEVVANVEGGYAQDTGRA
FT                   AVQDILQANPDVDVIAGASSAALLGAIELPGIDDVRIVGNGSSTQAVTAVQDGDFYAVY
FT                   VFAEKTAGAKAAEMGLAAARGEEVDPAYVGYDELTPFGVLGTKENLDGYTGEYSD"
     MHKIVRAAAV GVALSSALFL SACSDTAETA DAGSTSDESL SIGFFGFSKT NSFAQAAFAG        60
     ISEYAEANDA TAEFTDPNFD VQVQLQQLKD ALTSKRFDVW IVQANDGVAV QQTIQEAVDA       120
     GITVVAEFTP IGPDFETLKP QIPGTLSLVD DPKRNGTVLG ELSIDACADA GADPCEVAYL       180
     QGFSAQPIDV VRTDAFLAAV DRPGVEVVAN VEGGYAQDTG RAAVQDILQA NPDVDVIAGA       240
     SSAALLGAIE LPGIDDVRIV GNGSSTQAVT AVQDGDFYAV YVFAEKTAGA KAAEMGLAAA       300
     RGEEVDPAYV GYDELTPFGV LGTKENLDGY TGEYSD                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page