(data stored in ACNUC1104 zone)

EMBL: CP000509.PE75

CP000509.PE75        Location/Qualifiers
FT   CDS             88141..90204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0079"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   mta:Moth_1967 5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79625"
FT                   /db_xref="GOA:A1SCU0"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU0"
FT                   /protein_id="ABL79625.1"
FT                   /translation="MPGSSSSSVRVAVDVGGTFTDVVTLDSADGALRFDKVPTTPADAS
FT                   QGVINAFVRSGVDMQRAGYFTHGTTLGLNALLTRNGARTAIVTTDGFRDVYLLGRTDRP
FT                   VSYDFRYKKPESLVRRDAIFEVPERMNYQGRVLRPFDDVAARAVAERLKDAGYESVAVC
FT                   FLHAYTNPDHELRMREILADVAPEMDVTLSHELSREYREYERTSTAVFDGYIKPVVRRY
FT                   LGRLKNALAENGFGGHFFMIRSGGGAMTVESAREAPVNLILSGPAGGVIGATSFARTTG
FT                   EGNLITIDMGGTSLDASLIVDGESVLRHEAMFEGLPLAIPSLYIHTIGAGGGSLVWIDE
FT                   GGHLQVGPQSAGSSPGPAAYNWGGTQATFTDAALVVGYLGTETALAGSLELRRDLAEDA
FT                   LVPNAEALGMSVETVARGVLRIATTKIVGAVRSITVDIGYKPNDFALLTYGGGGGLVAV
FT                   DVAHELSIPRVIVPPGPGAFSALGMLMADVQHDYSRTQVAPLDGIDLQHLESTFGEMEG
FT                   EGGAALQDEGFAPEDRRFQRFIDVRYLGQEHAVSVPVERLSADEDIERLRHEFSEIHER
FT                   HYGHAMSDPIEIVTLRSRAVGVVERPRLPEVPEREGDVLTPIASRGVVQPDGSRTPYQV
FT                   YDRSHFRFGDRIEGPAIIVEHTSTTVMHTGDTAEVGRVGEIVITLAEETNRG"
     MPGSSSSSVR VAVDVGGTFT DVVTLDSADG ALRFDKVPTT PADASQGVIN AFVRSGVDMQ        60
     RAGYFTHGTT LGLNALLTRN GARTAIVTTD GFRDVYLLGR TDRPVSYDFR YKKPESLVRR       120
     DAIFEVPERM NYQGRVLRPF DDVAARAVAE RLKDAGYESV AVCFLHAYTN PDHELRMREI       180
     LADVAPEMDV TLSHELSREY REYERTSTAV FDGYIKPVVR RYLGRLKNAL AENGFGGHFF       240
     MIRSGGGAMT VESAREAPVN LILSGPAGGV IGATSFARTT GEGNLITIDM GGTSLDASLI       300
     VDGESVLRHE AMFEGLPLAI PSLYIHTIGA GGGSLVWIDE GGHLQVGPQS AGSSPGPAAY       360
     NWGGTQATFT DAALVVGYLG TETALAGSLE LRRDLAEDAL VPNAEALGMS VETVARGVLR       420
     IATTKIVGAV RSITVDIGYK PNDFALLTYG GGGGLVAVDV AHELSIPRVI VPPGPGAFSA       480
     LGMLMADVQH DYSRTQVAPL DGIDLQHLES TFGEMEGEGG AALQDEGFAP EDRRFQRFID       540
     VRYLGQEHAV SVPVERLSAD EDIERLRHEF SEIHERHYGH AMSDPIEIVT LRSRAVGVVE       600
     RPRLPEVPER EGDVLTPIAS RGVVQPDGSR TPYQVYDRSH FRFGDRIEGP AIIVEHTSTT       660
     VMHTGDTAEV GRVGEIVITL AEETNRG                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page