(data stored in ACNUC1104 zone)

EMBL: CP000509.PE79

CP000509.PE79        Location/Qualifiers
FT   CDS             94074..94412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV1733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79629"
FT                   /db_xref="GOA:A1SCU4"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU4"
FT                   /protein_id="ABL79629.1"
FT                   /translation="MSAFLRRAADDPIRRRDGKAISIRVDGEQLTGVEGQSIAGVLLAS
FT                   GRLDWRVTSIDGRPRGVFCGIGVCFDCLVTVNDEPDVRACLRRAVHGDVVARQHDPLPT
FT                   PVERGSDD"
     MSAFLRRAAD DPIRRRDGKA ISIRVDGEQL TGVEGQSIAG VLLASGRLDW RVTSIDGRPR        60
     GVFCGIGVCF DCLVTVNDEP DVRACLRRAV HGDVVARQHD PLPTPVERGS DD               112
//

If you have problems or comments...

PBIL Back to PBIL home page