(data stored in ACNUC1104 zone)

EMBL: CP000509.PE80

CP000509.PE80        Location/Qualifiers
FT   CDS             94405..95871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0084"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; BFD
FT                   domain protein [2Fe-2S]-binding domain protein;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sco:SCO6291 secreted oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79630"
FT                   /db_xref="GOA:A1SCU5"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU5"
FT                   /protein_id="ABL79630.1"
FT                   /translation="MTDVLVIGAGPAGLAAAAAAREAGGTVTLLDSSDLLGGQYWRHLP
FT                   SSRPAERERLLHHGWDTFAGLRERLASDPHVRIETSAQVWAVERGTGVPVVVHALVGPP
FT                   DAHGRERVALRPDAVVFATGAHDRTLPFPGWDLPGVFTGGAAQALAKGERIAVGRRVLV
FT                   AGAGPFLLPVAASLTQAGAAVVGVLEANRLSTLAKGWSRRPWHLWSTHAKARELAGYAA
FT                   RHLRHGIPYRTGRAVVAAHGTDRVTSVTTMAVDRAWAPVAGTERVIDVDALCVSHGFTP
FT                   RLELAVAAGCSLSPDRFVTTDRDQQTSVPGLYAAGEITGIGGVDLALAEGRIAGWFAAG
FT                   GRIDDRAIDHDLRQRDVYRAFAARLAQAHGIGSGWTRWLEHDTVVCRCEEVSFGRLCGA
FT                   ADATMTTSLRSLKLSSRAALGICQGRVCGRSVEEILGSRATGAPARDGVVADQRPIAAP
FT                   IRIGDLAARQGSPPPHAPPTSPSQTPNETE"
     MTDVLVIGAG PAGLAAAAAA REAGGTVTLL DSSDLLGGQY WRHLPSSRPA ERERLLHHGW        60
     DTFAGLRERL ASDPHVRIET SAQVWAVERG TGVPVVVHAL VGPPDAHGRE RVALRPDAVV       120
     FATGAHDRTL PFPGWDLPGV FTGGAAQALA KGERIAVGRR VLVAGAGPFL LPVAASLTQA       180
     GAAVVGVLEA NRLSTLAKGW SRRPWHLWST HAKARELAGY AARHLRHGIP YRTGRAVVAA       240
     HGTDRVTSVT TMAVDRAWAP VAGTERVIDV DALCVSHGFT PRLELAVAAG CSLSPDRFVT       300
     TDRDQQTSVP GLYAAGEITG IGGVDLALAE GRIAGWFAAG GRIDDRAIDH DLRQRDVYRA       360
     FAARLAQAHG IGSGWTRWLE HDTVVCRCEE VSFGRLCGAA DATMTTSLRS LKLSSRAALG       420
     ICQGRVCGRS VEEILGSRAT GAPARDGVVA DQRPIAAPIR IGDLAARQGS PPPHAPPTSP       480
     SQTPNETE                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page