(data stored in ACNUC1104 zone)

EMBL: CP000509.PE88

CP000509.PE88        Location/Qualifiers
FT   CDS             104442..105254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0093"
FT                   /product="protein of unknown function DUF1445"
FT                   /note="PFAM: protein of unknown function DUF1445; KEGG:
FT                   pst:PSPTO_5379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79638"
FT                   /db_xref="GOA:A1SCV3"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SCV3"
FT                   /protein_id="ABL79638.1"
FT                   /translation="MNSAVPGTTHDDIAALTPARARERFRAGERVATSGWCPGFTQANL
FT                   IAVPQQYAYDVLLFTQRNPKACPVIDVTDAGSVEPGIAPGADLRTDLPGYRVYEEGRLV
FT                   AETGDAREHWREDMVAFLIGCSFTFERALLESGVPVRHLTAGTNVPMYRTNRACRPAGR
FT                   LHGPMVVSMRAVPADQVAAAVQVTSRFPSMHGAPVHVGDPAALGIEDLAWPDYGDAPVL
FT                   ADGDVPVFWACGVTPQAVIAAVGIPYAVSHAPGQMFISDVPEATWALA"
     MNSAVPGTTH DDIAALTPAR ARERFRAGER VATSGWCPGF TQANLIAVPQ QYAYDVLLFT        60
     QRNPKACPVI DVTDAGSVEP GIAPGADLRT DLPGYRVYEE GRLVAETGDA REHWREDMVA       120
     FLIGCSFTFE RALLESGVPV RHLTAGTNVP MYRTNRACRP AGRLHGPMVV SMRAVPADQV       180
     AAAVQVTSRF PSMHGAPVHV GDPAALGIED LAWPDYGDAP VLADGDVPVF WACGVTPQAV       240
     IAAVGIPYAV SHAPGQMFIS DVPEATWALA                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page