(data stored in ACNUC1104 zone)

EMBL: CP000509.PE9

CP000509.PE9         Location/Qualifiers
FT   CDS             12546..13964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0009"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: plasmid pRiA4b ORF-3 family protein; KEGG:
FT                   cef:CE1215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79559"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM4"
FT                   /protein_id="ABL79559.1"
FT                   /translation="MADASPAEVRAVLDALGSGRVSSIFEKLERDQAPTLLTAPAQVRG
FT                   FRVRLDLHGAKPPVWRRLELPGDLSLPRVHAAIQAAMGWTNSHLHRFRTGCDRSSASFV
FT                   TQFDVDEGDEGTLEDDVRLDQLLAENGDELWYEYDFGDGWDHVLVVEEVLEEPPSTVRC
FT                   TGGRSACPPEDCGGLGGYQELAAWVRSGYDDGQLPDVFDDAEDARAWLPLDWHPDEFEV
FT                   EDADAAVAAAAAELVAVSGELAGLAAQLDRHGILLLRQVLSRPSSHGPIEVADAEAGRL
FT                   TETYRTFLEVIGDGVALTAAGHLPPAVVEKFAERSGIADWWIRKANREDATPPVANVRA
FT                   AVRLLGLVSVRKGRLAPTAAAIRCHQDPQALLRHIVERLPVGTQEWEREAGWMALAVAG
FT                   SGVPAEDWRAEISELTFALGWRGDPGDDSLPSPRSRTLRVLDDLGGAARHPWGRNEGVD
FT                   AAVAAVARAVTRRA"
     MADASPAEVR AVLDALGSGR VSSIFEKLER DQAPTLLTAP AQVRGFRVRL DLHGAKPPVW        60
     RRLELPGDLS LPRVHAAIQA AMGWTNSHLH RFRTGCDRSS ASFVTQFDVD EGDEGTLEDD       120
     VRLDQLLAEN GDELWYEYDF GDGWDHVLVV EEVLEEPPST VRCTGGRSAC PPEDCGGLGG       180
     YQELAAWVRS GYDDGQLPDV FDDAEDARAW LPLDWHPDEF EVEDADAAVA AAAAELVAVS       240
     GELAGLAAQL DRHGILLLRQ VLSRPSSHGP IEVADAEAGR LTETYRTFLE VIGDGVALTA       300
     AGHLPPAVVE KFAERSGIAD WWIRKANRED ATPPVANVRA AVRLLGLVSV RKGRLAPTAA       360
     AIRCHQDPQA LLRHIVERLP VGTQEWEREA GWMALAVAGS GVPAEDWRAE ISELTFALGW       420
     RGDPGDDSLP SPRSRTLRVL DDLGGAARHP WGRNEGVDAA VAAVARAVTR RA               472
//

If you have problems or comments...

PBIL Back to PBIL home page