(data stored in ACNUC1104 zone)

EMBL: CP000509.PE90

CP000509.PE90        Location/Qualifiers
FT   CDS             106207..107760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0095"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: mlo:mll9131
FT                   hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79640"
FT                   /db_xref="GOA:A1SCV5"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV5"
FT                   /protein_id="ABL79640.1"
FT                   /translation="MRIGIDVGGTNTDAVLMDGHQVMGAVKSATQPDVSSGIKATLESL
FT                   RKQRPFAPEDIRAVMIGTTHFINALVEARHLAPTAVLRLGLPATSSLPPLVDWPERLVE
FT                   AIGGRAYLAHGGHEFDGRHIAELDEDELRRHVQDMVAHGLRSLAISSVFSPINSEFELR
FT                   AAEIVAEEAGPEMAVSMSHEIGRVGLLERENATIINAALRELALGIVDGLAGTLASLGI
FT                   DSPLYLSQNDGTLMDMDFARRYPVATFASGPTNSMRGAAILSGLKDCAVVDVGGTTSDV
FT                   GVLTNGFPREATTEVTVAGVRTNFRMPDVLSIGIGGGSLVRGNEAGVTVGPDSVGYRLT
FT                   QEALVLGGSTLTATDIAVASGRADIGDRSLVAHLDRATIEAALARIGSDVADAVERMRT
FT                   SADALPVVAVGGGSILLPDRLEGCGDVHRPEHFSVANAIGAAIAQVGGMVDRIYSIAPG
FT                   QRDAICDEARQEAKDRAVAAGADPETVSIADFDEVPIPYLPGNATRIRCKAVGDLWMER
FT                   "
     MRIGIDVGGT NTDAVLMDGH QVMGAVKSAT QPDVSSGIKA TLESLRKQRP FAPEDIRAVM        60
     IGTTHFINAL VEARHLAPTA VLRLGLPATS SLPPLVDWPE RLVEAIGGRA YLAHGGHEFD       120
     GRHIAELDED ELRRHVQDMV AHGLRSLAIS SVFSPINSEF ELRAAEIVAE EAGPEMAVSM       180
     SHEIGRVGLL ERENATIINA ALRELALGIV DGLAGTLASL GIDSPLYLSQ NDGTLMDMDF       240
     ARRYPVATFA SGPTNSMRGA AILSGLKDCA VVDVGGTTSD VGVLTNGFPR EATTEVTVAG       300
     VRTNFRMPDV LSIGIGGGSL VRGNEAGVTV GPDSVGYRLT QEALVLGGST LTATDIAVAS       360
     GRADIGDRSL VAHLDRATIE AALARIGSDV ADAVERMRTS ADALPVVAVG GGSILLPDRL       420
     EGCGDVHRPE HFSVANAIGA AIAQVGGMVD RIYSIAPGQR DAICDEARQE AKDRAVAAGA       480
     DPETVSIADF DEVPIPYLPG NATRIRCKAV GDLWMER                                517
//

If you have problems or comments...

PBIL Back to PBIL home page