(data stored in SCRATCH zone)

EMBL: CP000509.PE92

CP000509.PE92        Location/Qualifiers
FT   CDS             complement(108849..110423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0097"
FT                   /product="Regulator of polyketide synthase expression-like
FT                   protein"
FT                   /note="KEGG: sco:SCO1052 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79642"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV7"
FT                   /protein_id="ABL79642.1"
FT                   /translation="MSAASPVPLVALLAHADWQQVSVLAAPPAPTLTVGGVAMVADIRG
FT                   RAADLEGNLLTVLQPPLRDDWQIDVLIQTAAAGRASALLIGDSSPLSQPSSALAARVGL
FT                   TVLGADDPLAAALTARRLVAEVELHVSDTVLRVTAAAARSGEGVEDVMKAVGSVLHRPL
FT                   ALVAAGGDTLLGSDVVAGEDRETVAGTLTAGAARYRATQRVELSDSALLIAHPVPPTTA
FT                   RDATVWLVTRLPHDLPAESAAASAALSVAAAVIGQRASLRRLAVERDARARASLLGELL
FT                   NAPDDVAPTTRRRALEAGWRLDGWHLGIRIDTGPEVDPVAQRPEVIGALQAEGMDAVVV
FT                   EQGDGWSAWITSEDEPRGADVEARAGQIRSAQRRLAATTPTAVGVGRYHAGPRGVARTL
FT                   GEAGEAARLAAGRVASGRFLHVDRLGLGQTLLAWTRTDTFQPAARSLLAPLEGQPGDLL
FT                   HTLTTYLDEESSVSETAAILGIHRNTVAQRLARIRSLLAVDLADPSERLALHLACRTIW
FT                   IPPSDVG"
     MSAASPVPLV ALLAHADWQQ VSVLAAPPAP TLTVGGVAMV ADIRGRAADL EGNLLTVLQP        60
     PLRDDWQIDV LIQTAAAGRA SALLIGDSSP LSQPSSALAA RVGLTVLGAD DPLAAALTAR       120
     RLVAEVELHV SDTVLRVTAA AARSGEGVED VMKAVGSVLH RPLALVAAGG DTLLGSDVVA       180
     GEDRETVAGT LTAGAARYRA TQRVELSDSA LLIAHPVPPT TARDATVWLV TRLPHDLPAE       240
     SAAASAALSV AAAVIGQRAS LRRLAVERDA RARASLLGEL LNAPDDVAPT TRRRALEAGW       300
     RLDGWHLGIR IDTGPEVDPV AQRPEVIGAL QAEGMDAVVV EQGDGWSAWI TSEDEPRGAD       360
     VEARAGQIRS AQRRLAATTP TAVGVGRYHA GPRGVARTLG EAGEAARLAA GRVASGRFLH       420
     VDRLGLGQTL LAWTRTDTFQ PAARSLLAPL EGQPGDLLHT LTTYLDEESS VSETAAILGI       480
     HRNTVAQRLA RIRSLLAVDL ADPSERLALH LACRTIWIPP SDVG                        524
//

If you have problems or comments...

PBIL Back to PBIL home page