(data stored in ACNUC1104 zone)

EMBL: CP000509.PE96

CP000509.PE96        Location/Qualifiers
FT   CDS             114503..115531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0101"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rha:RHA1_ro11174 ABC sugar transporter, permease component;
FT                   TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79646"
FT                   /db_xref="GOA:A1SCW1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW1"
FT                   /protein_id="ABL79646.1"
FT                   /translation="MSVGTTTGHDTDAVAPAQPGARRWTSRIEAGALPAAWLVVFVVFA
FT                   VLLPDTFLSTASVSNILGSQAVPLVLTLCLVLPLVCGDYDMSVASVATLTAMVIGILNV
FT                   NHGWSIGAAILAGLLAALLAGLVNGAVIVIFGVDSLIVTLGTGTVIQGLVLWISDSTTV
FT                   SGISTSLVDLVIGYKLFSVPAAFYYGLALCVVLWYLLQHTALGMRMLFIGRGRDVARLS
FT                   GIAVPRVRMGALVASAGLAGVAGTLYAGTTGSADPSSGTSFLLPAFAAVFLGATTVIPG
FT                   RFNAWGAFIAVYFLATGITGLQLLGAESFVQQLFYGGALVIAVSLAQLARRREASSAGT
FT                   TS"
     MSVGTTTGHD TDAVAPAQPG ARRWTSRIEA GALPAAWLVV FVVFAVLLPD TFLSTASVSN        60
     ILGSQAVPLV LTLCLVLPLV CGDYDMSVAS VATLTAMVIG ILNVNHGWSI GAAILAGLLA       120
     ALLAGLVNGA VIVIFGVDSL IVTLGTGTVI QGLVLWISDS TTVSGISTSL VDLVIGYKLF       180
     SVPAAFYYGL ALCVVLWYLL QHTALGMRML FIGRGRDVAR LSGIAVPRVR MGALVASAGL       240
     AGVAGTLYAG TTGSADPSSG TSFLLPAFAA VFLGATTVIP GRFNAWGAFI AVYFLATGIT       300
     GLQLLGAESF VQQLFYGGAL VIAVSLAQLA RRREASSAGT TS                          342
//

If you have problems or comments...

PBIL Back to PBIL home page