(data stored in ACNUC1104 zone)

EMBL: CP000509.PE97

CP000509.PE97        Location/Qualifiers
FT   CDS             115531..116544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0102"
FT                   /product="dipeptidase, Metallo peptidase, MEROPS family
FT                   M19"
FT                   /note="PFAM: peptidase M19, renal dipeptidase; KEGG:
FT                   dsy:DSY1937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79647"
FT                   /db_xref="GOA:A1SCW2"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW2"
FT                   /protein_id="ABL79647.1"
FT                   /translation="MVVPTLPVADCHNDLLLGVLHQRERGIADPFGDFWLPQLRAGGVA
FT                   LQVLPVFTEEQHVGEGALRRSLQVLEEARRLADVHVADVAICERGDQIRPTIESGRIAL
FT                   VLALEGCEPVGHSLELLDTFHRLGVRIASMTWNRRTMMADGVGEQDAGGRLTTLGLEAV
FT                   AEMERLGMLVDVSHLSETGFWHLASVATRPFVASHSSCRALQPHPRNLTDEQIRAVADS
FT                   GGFVAINGFGPFLSDAPTVDSFLDHVQHAVALVGPERVALGLDFMRDLVDAVDPVLSGA
FT                   LVHPDTPPWVAGLERPADLAALAARLEETLGPRAGRQVAADTVIDTLTRQLAPAPR"
     MVVPTLPVAD CHNDLLLGVL HQRERGIADP FGDFWLPQLR AGGVALQVLP VFTEEQHVGE        60
     GALRRSLQVL EEARRLADVH VADVAICERG DQIRPTIESG RIALVLALEG CEPVGHSLEL       120
     LDTFHRLGVR IASMTWNRRT MMADGVGEQD AGGRLTTLGL EAVAEMERLG MLVDVSHLSE       180
     TGFWHLASVA TRPFVASHSS CRALQPHPRN LTDEQIRAVA DSGGFVAING FGPFLSDAPT       240
     VDSFLDHVQH AVALVGPERV ALGLDFMRDL VDAVDPVLSG ALVHPDTPPW VAGLERPADL       300
     AALAARLEET LGPRAGRQVA ADTVIDTLTR QLAPAPR                                337
//

If you have problems or comments...

PBIL Back to PBIL home page