(data stored in ACNUC1104 zone)

EMBL: CP000509.PE99

CP000509.PE99        Location/Qualifiers
FT   CDS             117020..117724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79649"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW4"
FT                   /protein_id="ABL79649.1"
FT                   /translation="MTDEWEIGERARRMMQNLPRFLENFEGIWAERRAEVDSWWTHLQS
FT                   VDLRSLQLPELGGYLRKARQFHKRAFEIHFEVMYPLIANYVGFYGACTEMGIDPGQIAK
FT                   MVVAVHQLPFLPRGAAGLSLADLAGARDAADGGLWITGVPSGSPSGRLVVHGRPGGVAQ
FT                   RLAVAAAARTDRNGERPRSSARRPPPREPRPRLSMRRDPPVGRPSRRKWTSRTCARCYA
FT                   GALSYAPTARGA"
     MTDEWEIGER ARRMMQNLPR FLENFEGIWA ERRAEVDSWW THLQSVDLRS LQLPELGGYL        60
     RKARQFHKRA FEIHFEVMYP LIANYVGFYG ACTEMGIDPG QIAKMVVAVH QLPFLPRGAA       120
     GLSLADLAGA RDAADGGLWI TGVPSGSPSG RLVVHGRPGG VAQRLAVAAA ARTDRNGERP       180
     RSSARRPPPR EPRPRLSMRR DPPVGRPSRR KWTSRTCARC YAGALSYAPT ARGA             234
//

If you have problems or comments...

PBIL Back to PBIL home page