(data stored in ACNUC29543 zone)

EMBL: CP000521.PE100

CP000521.PE100       Location/Qualifiers
FT   CDS             117345..118784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0098"
FT                   /product="D-serine/D-alanine/glycine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10587"
FT                   /protein_id="ABO10587.2"
FT                   /translation="MTTARHSDMENSPDHLQRKLSNRHLQLIAIGGAIGTGLFMGSGKT
FT                   ISLAGPSILFIYMIIGGMFFFLMRAMGELLLANLHYKSFVDMAHDLIGPWAGYYLGWTY
FT                   WLGWVLVGIADLSAVINYLSFWLPDGASFSPIQQAMISAGCVLFVMGLNLLTVRLFGEI
FT                   EFWFALIKILAIIGLIGVGGYMIFSHFQAPQGAVASISNVWSHGGLFPKGTEGFLAGFQ
FT                   IAVFAFVGVELVGTTAAETKDPQKNLPKAINAIPVRIILFYVLALFIVMSVTPWDHIRA
FT                   DKSPFVELFLNAGIPVSAIIMNLVVLSSVMSSMNSGVFSTSRMLFGLSKDGQAPGAFGR
FT                   LSKRAVPSNGLIFSCTFIMGGAVLQYFVPNTMEAFTLASSLCVILFISVWSLIMVCYLR
FT                   YRKLRPELHEKSTFKMPGGIWMSYVVLAFMLFTLVILALEPDTLKALYVSPVWLIILGV
FT                   TYHVLYKPRMKRLGRELVNDH"
     MTTARHSDME NSPDHLQRKL SNRHLQLIAI GGAIGTGLFM GSGKTISLAG PSILFIYMII        60
     GGMFFFLMRA MGELLLANLH YKSFVDMAHD LIGPWAGYYL GWTYWLGWVL VGIADLSAVI       120
     NYLSFWLPDG ASFSPIQQAM ISAGCVLFVM GLNLLTVRLF GEIEFWFALI KILAIIGLIG       180
     VGGYMIFSHF QAPQGAVASI SNVWSHGGLF PKGTEGFLAG FQIAVFAFVG VELVGTTAAE       240
     TKDPQKNLPK AINAIPVRII LFYVLALFIV MSVTPWDHIR ADKSPFVELF LNAGIPVSAI       300
     IMNLVVLSSV MSSMNSGVFS TSRMLFGLSK DGQAPGAFGR LSKRAVPSNG LIFSCTFIMG       360
     GAVLQYFVPN TMEAFTLASS LCVILFISVW SLIMVCYLRY RKLRPELHEK STFKMPGGIW       420
     MSYVVLAFML FTLVILALEP DTLKALYVSP VWLIILGVTY HVLYKPRMKR LGRELVNDH        479
//

If you have problems or comments...

PBIL Back to PBIL home page