(data stored in ACNUC29543 zone)

EMBL: CP000521.PE101

CP000521.PE101       Location/Qualifiers
FT   CDS             119155..120585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0099"
FT                   /product="D-serine/D-alanine/glycine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10588"
FT                   /protein_id="ABO10588.2"
FT                   /translation="MTMVHHSDEASSPDHLQRKLSNRHLQLIAIGGAIGTGLFMGSGKT
FT                   ISLAGPSILVIYMLIGGMFFFLMRALGELLLANLHYKSFVDMAYDLIGPWAGYYIGWTY
FT                   WLGWVLVGIADLSAVINYLSFWLPEGASFSPMQQAMISAGCVLFVLGLNLLTVKLFGEV
FT                   EFWFALIKILAIIGLIGVGGYMILTHFQAPHGDVVSISNVWSHGGLFPKGVSGFLAGFQ
FT                   IAVFAFIGVELIGTTAAETKDPQTNLPKAINAIPVRIILFYVLALFVVMSVTPWNHIRA
FT                   DKSPFVELFLNAGIPISAIIMNLVVLSSVMSSMNSGVFSTSRMLFGLSKDGQAPSVLGR
FT                   LSKRAVPSNGLIFSCIFIMGGAVLQYFVPNTMEAFTLASSLCVILFISVWILIMACYLR
FT                   YRKIRPELHAASTFKMPGGVLMAYAVIAFFLFTLVILALEPDTLKALYVSPVWLVVLSV
FT                   TYYVFYKPRMRKLGQEIF"
     MTMVHHSDEA SSPDHLQRKL SNRHLQLIAI GGAIGTGLFM GSGKTISLAG PSILVIYMLI        60
     GGMFFFLMRA LGELLLANLH YKSFVDMAYD LIGPWAGYYI GWTYWLGWVL VGIADLSAVI       120
     NYLSFWLPEG ASFSPMQQAM ISAGCVLFVL GLNLLTVKLF GEVEFWFALI KILAIIGLIG       180
     VGGYMILTHF QAPHGDVVSI SNVWSHGGLF PKGVSGFLAG FQIAVFAFIG VELIGTTAAE       240
     TKDPQTNLPK AINAIPVRII LFYVLALFVV MSVTPWNHIR ADKSPFVELF LNAGIPISAI       300
     IMNLVVLSSV MSSMNSGVFS TSRMLFGLSK DGQAPSVLGR LSKRAVPSNG LIFSCIFIMG       360
     GAVLQYFVPN TMEAFTLASS LCVILFISVW ILIMACYLRY RKIRPELHAA STFKMPGGVL       420
     MAYAVIAFFL FTLVILALEP DTLKALYVSP VWLVVLSVTY YVFYKPRMRK LGQEIF           476
//

If you have problems or comments...

PBIL Back to PBIL home page