(data stored in ACNUC29543 zone)

EMBL: CP000521.PE107

CP000521.PE107       Location/Qualifiers
FT   CDS             127786..128811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0107"
FT                   /product="putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10594"
FT                   /protein_id="ABO10594.2"
FT                   /translation="MNTENHLMIEQQGKLGIITLDRVTHLNALSLDMIKSIGAQLELWR
FT                   NDAAVQAVLIKSNSPKAFCAGGDIRYLYDSYKNGTADYKGYFSAEYKMLDILREYAKPV
FT                   IVMLDGYVLGGGFGLAQACHIVVSSEKSRFAMPETAIGFFPDVGATHFLSRLDDIGVYM
FT                   AITGEQISSSDALYLDLIDYHVPSEQLQALQDALVEAPSLTKEGIEHIITRFITHPAES
FT                   ELKQLAEGIRKHFGYQHLDEIEQSLENEQDESLKTWASKMLSILQQRSFIAKQTSLKLQ
FT                   HLGRGLSLQQCMQLERDLQDIWFEHGDFIEGVRALIVDKDKQPRWQERNPELEQILEKL
FT                   S"
     MNTENHLMIE QQGKLGIITL DRVTHLNALS LDMIKSIGAQ LELWRNDAAV QAVLIKSNSP        60
     KAFCAGGDIR YLYDSYKNGT ADYKGYFSAE YKMLDILREY AKPVIVMLDG YVLGGGFGLA       120
     QACHIVVSSE KSRFAMPETA IGFFPDVGAT HFLSRLDDIG VYMAITGEQI SSSDALYLDL       180
     IDYHVPSEQL QALQDALVEA PSLTKEGIEH IITRFITHPA ESELKQLAEG IRKHFGYQHL       240
     DEIEQSLENE QDESLKTWAS KMLSILQQRS FIAKQTSLKL QHLGRGLSLQ QCMQLERDLQ       300
     DIWFEHGDFI EGVRALIVDK DKQPRWQERN PELEQILEKL S                           341
//

If you have problems or comments...

PBIL Back to PBIL home page