(data stored in ACNUC29543 zone)

EMBL: CP000521.PE114

CP000521.PE114       Location/Qualifiers
FT   CDS             137227..137487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0114"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10601"
FT                   /protein_id="ABO10601.1"
FT                   /translation="MNKDKAYWSAIIRTLVAKEMRVEPETIDPDQKFTSYGLDSIVALS
FT                   VSGDLEDLTKLELEPTLLWDYPTINALAEYLVSELQQGVAS"
     MNKDKAYWSA IIRTLVAKEM RVEPETIDPD QKFTSYGLDS IVALSVSGDL EDLTKLELEP        60
     TLLWDYPTIN ALAEYLVSEL QQGVAS                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page