(data stored in ACNUC29543 zone)

EMBL: CP000521.PE117

CP000521.PE117       Location/Qualifiers
FT   CDS             145115..146389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10604"
FT                   /protein_id="ABO10604.2"
FT                   /translation="MTQGAYWVFVCCSSFMLLQHTYADDSEMSFVSQNSARLDVWSSDR
FT                   DLSSLKNIGQASFWSNGTLKFNPAFKLHYDIVVSDETDHTVNPDQVSKVNRNLRELYAS
FT                   YNWDQTFYLDLGRQIVVWGRADGINPTDNLSPRDYTRLVPDETDQRLGNDALKLTYIPE
FT                   SGTNKWTALWYPRSRSDVIPLRQIAGVQYDIDRKSRPAFAMRWDYSVDGLDVGASYFSG
FT                   LDHMPDLSVLSASPTGEATLQLKNNPMSVYGFDFSYNHNDLVWRGEAAYTKTDSNGSED
FT                   LIHKKNNLTVVMGPEWSLKNSTLSLVGVYKHTEDFKSADNLTNLLVREVYRYQQTISDQ
FT                   YEQDQYGAMLRYALNLLNDNLKLEFTGFYFAPEPNELLRVRINYNLNDHWQLNAGGDRF
FT                   WGRNDTVLGQFRDNSLVYAQVRYNF"
     MTQGAYWVFV CCSSFMLLQH TYADDSEMSF VSQNSARLDV WSSDRDLSSL KNIGQASFWS        60
     NGTLKFNPAF KLHYDIVVSD ETDHTVNPDQ VSKVNRNLRE LYASYNWDQT FYLDLGRQIV       120
     VWGRADGINP TDNLSPRDYT RLVPDETDQR LGNDALKLTY IPESGTNKWT ALWYPRSRSD       180
     VIPLRQIAGV QYDIDRKSRP AFAMRWDYSV DGLDVGASYF SGLDHMPDLS VLSASPTGEA       240
     TLQLKNNPMS VYGFDFSYNH NDLVWRGEAA YTKTDSNGSE DLIHKKNNLT VVMGPEWSLK       300
     NSTLSLVGVY KHTEDFKSAD NLTNLLVREV YRYQQTISDQ YEQDQYGAML RYALNLLNDN       360
     LKLEFTGFYF APEPNELLRV RINYNLNDHW QLNAGGDRFW GRNDTVLGQF RDNSLVYAQV       420
     RYNF                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page