(data stored in ACNUC29543 zone)

EMBL: CP000521.PE118

CP000521.PE118       Location/Qualifiers
FT   CDS             146443..148308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10605"
FT                   /protein_id="ABO10605.2"
FT                   /translation="MDNLNNAKKDNFSRKTILVTGAAGFIGSRLIVELLREGHQVIAAL
FT                   RNAATKKDKLLGFIATQGLADPSISFVEYDLSRDFKLDSLLSDAQTKIHVIYHLAASFN
FT                   WGISKAEAERTNIKSGLALIEWAATLKQLERFIWIGGYRVAAPPQESADELYCKHGGYE
FT                   ASKILGHQAFIEACKRLNVPWTAINPATVIDGFYNYGDMQCIGIADMIDKLYQGRLLAL
FT                   PGGRDTFLPLCNMQYIVSFLIRTMSYPETIAQEYMLLDPATPKFHRLVYLAAEHLGVSS
FT                   PHLQIPKVLLEKLPEVLLDGSKEQLSFISTEHYHVAGAEAMAAKMGITDLISIMPYFSR
FT                   WIDRLVFTRFGRMQVPTPNSFSYQNRYWTEIYTKQPVGSEKASALFLHGIPFDSACWSP
FT                   IINKITYDQVAMMDLPGLGRSGSYEMMEDNNHQFIDTAAELLAPNSVVIAHSLGCLFAL
FT                   NLAKKYPDKVARLILISPYFVQAQAAKMFQIQAISKLIFRFVPKDVIAKDLHPEGQQNL
FT                   SVRYAMDSLRRMSVSKHISEYMHHINLPQQRAAQTALLSELRSKIEIIVGEKDPIVTPI
FT                   SPEIPVHIIAGAGHNPHVTHVEAVYDYLTPVLTKYISTTAQLSDV"
     MDNLNNAKKD NFSRKTILVT GAAGFIGSRL IVELLREGHQ VIAALRNAAT KKDKLLGFIA        60
     TQGLADPSIS FVEYDLSRDF KLDSLLSDAQ TKIHVIYHLA ASFNWGISKA EAERTNIKSG       120
     LALIEWAATL KQLERFIWIG GYRVAAPPQE SADELYCKHG GYEASKILGH QAFIEACKRL       180
     NVPWTAINPA TVIDGFYNYG DMQCIGIADM IDKLYQGRLL ALPGGRDTFL PLCNMQYIVS       240
     FLIRTMSYPE TIAQEYMLLD PATPKFHRLV YLAAEHLGVS SPHLQIPKVL LEKLPEVLLD       300
     GSKEQLSFIS TEHYHVAGAE AMAAKMGITD LISIMPYFSR WIDRLVFTRF GRMQVPTPNS       360
     FSYQNRYWTE IYTKQPVGSE KASALFLHGI PFDSACWSPI INKITYDQVA MMDLPGLGRS       420
     GSYEMMEDNN HQFIDTAAEL LAPNSVVIAH SLGCLFALNL AKKYPDKVAR LILISPYFVQ       480
     AQAAKMFQIQ AISKLIFRFV PKDVIAKDLH PEGQQNLSVR YAMDSLRRMS VSKHISEYMH       540
     HINLPQQRAA QTALLSELRS KIEIIVGEKD PIVTPISPEI PVHIIAGAGH NPHVTHVEAV       600
     YDYLTPVLTK YISTTAQLSD V                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page