(data stored in ACNUC29543 zone)

EMBL: CP000521.PE123

CP000521.PE123       Location/Qualifiers
FT   CDS             151229..151615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10610"
FT                   /protein_id="ABO10610.2"
FT                   /translation="MKGLYIVPLAAATLLLGACATTVKPTYVSPTQYQSLSCQQLQSEY
FT                   NRIQQYIDNGVQTPKSTGMGVGLGLGGGWGRGGWGFGPSISVNMGQSSSTKNTELSRVL
FT                   GQQEAIVQAAQFKNCPIIVRKKTN"
     MKGLYIVPLA AATLLLGACA TTVKPTYVSP TQYQSLSCQQ LQSEYNRIQQ YIDNGVQTPK        60
     STGMGVGLGL GGGWGRGGWG FGPSISVNMG QSSSTKNTEL SRVLGQQEAI VQAAQFKNCP       120
     IIVRKKTN                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page