(data stored in ACNUC29543 zone)

EMBL: CP000521.PE124

CP000521.PE124       Location/Qualifiers
FT   CDS             151831..152421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0126"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10611"
FT                   /protein_id="ABO10611.2"
FT                   /translation="MIESWFFVLAMLAVLLIPGPTNALLATAAHSQGLSKTFWLIPMEW
FT                   LGYAYGISFWAVFIHLADPVWPALLLILHITSVLYVFWMAFRLWKTTHLQQFSQNHRNI
FT                   RPRQLFFSTLKNPKSLLFAAGIFPAETWNSPENFLMVLAAFTLILIPAASFWMFFGRAL
FT                   LTGSMKKIKADHLYKGSAMLLILCMLPVVFRFF"
     MIESWFFVLA MLAVLLIPGP TNALLATAAH SQGLSKTFWL IPMEWLGYAY GISFWAVFIH        60
     LADPVWPALL LILHITSVLY VFWMAFRLWK TTHLQQFSQN HRNIRPRQLF FSTLKNPKSL       120
     LFAAGIFPAE TWNSPENFLM VLAAFTLILI PAASFWMFFG RALLTGSMKK IKADHLYKGS       180
     AMLLILCMLP VVFRFF                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page