(data stored in ACNUC29543 zone)

EMBL: CP000521.PE125

CP000521.PE125       Location/Qualifiers
FT   CDS             complement(152429..153070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0127"
FT                   /product="putative integral membrane protein (DedA)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10612"
FT                   /protein_id="ABO10612.2"
FT                   /translation="MELLDFILHVDQHLAEFITNYGTWIYGILFLIIFVETGLVVMPFL
FT                   PGDSLLFAAGALAASTGTMDPWLLGILLFIAAVLGDTVNYHIGRFIGPRVFEMNSRFIN
FT                   KQHLIKTHEFFARHGGKTIIFARFIPFARTFAPFVAGAGSMNYKFFLTYNIIGAFCWVA
FT                   SFVTLGYLFGGHPLVKDNFTHLIFGIIIISILPGVIGFIRQKLKNRKANV"
     MELLDFILHV DQHLAEFITN YGTWIYGILF LIIFVETGLV VMPFLPGDSL LFAAGALAAS        60
     TGTMDPWLLG ILLFIAAVLG DTVNYHIGRF IGPRVFEMNS RFINKQHLIK THEFFARHGG       120
     KTIIFARFIP FARTFAPFVA GAGSMNYKFF LTYNIIGAFC WVASFVTLGY LFGGHPLVKD       180
     NFTHLIFGII IISILPGVIG FIRQKLKNRK ANV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page