(data stored in ACNUC29543 zone)

EMBL: CP000521.PE127

CP000521.PE127       Location/Qualifiers
FT   CDS             complement(153760..154989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10614"
FT                   /protein_id="ABO10614.2"
FT                   /translation="MLQTMIADFQQHFWLYVSIPFMSGLIGYVTKVIAIQMMFSPLEFK
FT                   GIKPFFGWQGIVPRKAEKMATTAVELMTAKLIKPEEIFARLDPKRIAKEIEKPLMAAAE
FT                   DITREVAQEYQPGLWEGMPEFARQRLIRRVQSKAPEIVEHIMSEVQRDVNRYFDIKHLV
FT                   ISNLLKDKRLLNNIFKRVGKQEFKFFSNVGFVFGFGIGVIQMLCWIATQGKYPWMLPLF
FT                   GGFVGFFSDWIALQMMFRPLYPKKILGYTWQGLFIKRQNEVAADYAALISKQLLTSRHM
FT                   MEELFSGTHSARVIELVNRHVKQEIDMQAGVIRPLVVYAIGGEKYQNMKTQVAERIMQQ
FT                   LPETMKYVESYAEDAMNIRNTLIERMQKLTPSEFEGMLRPAFKEDEWALIAVGAVLGFV
FT                   VGELQIQFML"
     MLQTMIADFQ QHFWLYVSIP FMSGLIGYVT KVIAIQMMFS PLEFKGIKPF FGWQGIVPRK        60
     AEKMATTAVE LMTAKLIKPE EIFARLDPKR IAKEIEKPLM AAAEDITREV AQEYQPGLWE       120
     GMPEFARQRL IRRVQSKAPE IVEHIMSEVQ RDVNRYFDIK HLVISNLLKD KRLLNNIFKR       180
     VGKQEFKFFS NVGFVFGFGI GVIQMLCWIA TQGKYPWMLP LFGGFVGFFS DWIALQMMFR       240
     PLYPKKILGY TWQGLFIKRQ NEVAADYAAL ISKQLLTSRH MMEELFSGTH SARVIELVNR       300
     HVKQEIDMQA GVIRPLVVYA IGGEKYQNMK TQVAERIMQQ LPETMKYVES YAEDAMNIRN       360
     TLIERMQKLT PSEFEGMLRP AFKEDEWALI AVGAVLGFVV GELQIQFML                   409
//

If you have problems or comments...

PBIL Back to PBIL home page