(data stored in ACNUC29543 zone)

EMBL: CP000521.PE13

CP000521.PE13        Location/Qualifiers
FT   CDS             complement(14971..16098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10510"
FT                   /protein_id="ABO10510.2"
FT                   /translation="MSAIYIGVMTGTSMDGVDIVAASFEPLQLHATLTVPFEPELRDEL
FT                   MALTLPDDNEIDRMGKADVALAKMIGHGINSLIEKHQLDRNQIKAIGSHGQTIRHRPEH
FT                   GFTLQIGDPNIITEITQIPVVSDFRRRDMAAGGQGAPLVPAFHQALFQHPSIHRVILNL
FT                   GGIANVSMLPANNPDGVFGFDTGPANILMDAWCHRHTGHPYDENGDWAAYGHPIRSLLD
FT                   RLYAHEYFSKEPPKSTGREDFNIDWLDDQLIDWRNDLTYDELEDTPENIQATLLKLTVR
FT                   AIQKAIYRSNMETGEVYVCGGGAYNSYLLEQLRWRLRKHNWSVQTTDVLGLSPTWVEAT
FT                   AFAWLAMRFVDGLSGNLPAVTGASDFRILGTITAV"
     MSAIYIGVMT GTSMDGVDIV AASFEPLQLH ATLTVPFEPE LRDELMALTL PDDNEIDRMG        60
     KADVALAKMI GHGINSLIEK HQLDRNQIKA IGSHGQTIRH RPEHGFTLQI GDPNIITEIT       120
     QIPVVSDFRR RDMAAGGQGA PLVPAFHQAL FQHPSIHRVI LNLGGIANVS MLPANNPDGV       180
     FGFDTGPANI LMDAWCHRHT GHPYDENGDW AAYGHPIRSL LDRLYAHEYF SKEPPKSTGR       240
     EDFNIDWLDD QLIDWRNDLT YDELEDTPEN IQATLLKLTV RAIQKAIYRS NMETGEVYVC       300
     GGGAYNSYLL EQLRWRLRKH NWSVQTTDVL GLSPTWVEAT AFAWLAMRFV DGLSGNLPAV       360
     TGASDFRILG TITAV                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page