(data stored in ACNUC29543 zone)

EMBL: CP000521.PE131

CP000521.PE131       Location/Qualifiers
FT   CDS             158594..158899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10618"
FT                   /protein_id="ABO10618.1"
FT                   /translation="MKQHQYHVTVQHLKDAKGEVSTYTERLEFYTGNHDDIFEIVEKLK
FT                   NAEFFDDQTTKSFAVGLKLFSEVMLENRDHPLFQEFLPQFGQFMKNLKQQVKTQSP"
     MKQHQYHVTV QHLKDAKGEV STYTERLEFY TGNHDDIFEI VEKLKNAEFF DDQTTKSFAV        60
     GLKLFSEVML ENRDHPLFQE FLPQFGQFMK NLKQQVKTQS P                           101
//

If you have problems or comments...

PBIL Back to PBIL home page