(data stored in ACNUC29543 zone)

EMBL: CP000521.PE133

CP000521.PE133       Location/Qualifiers
FT   CDS             160000..160407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10620"
FT                   /protein_id="ABO10620.2"
FT                   /translation="MTAVIASSKAKPLAEQWKGEITSGRHQYFCDEPEKLEGHDQGPAP
FT                   YDLLTGSLAACTLITLRMYAKHKGYDFGEYSVEIDFHTNREHEEHIERRIVFKELPNEE
FT                   LQQKILTICSKTPVTKTLLRSLDIHTVLVTA"
     MTAVIASSKA KPLAEQWKGE ITSGRHQYFC DEPEKLEGHD QGPAPYDLLT GSLAACTLIT        60
     LRMYAKHKGY DFGEYSVEID FHTNREHEEH IERRIVFKEL PNEELQQKIL TICSKTPVTK       120
     TLLRSLDIHT VLVTA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page