(data stored in ACNUC29543 zone)

EMBL: CP000521.PE138

CP000521.PE138       Location/Qualifiers
FT   CDS             167143..167742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0142"
FT                   /product="homoserine/homoserine lactone efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10625"
FT                   /protein_id="ABO10625.2"
FT                   /translation="MLACWVISISPGAGAIASMSSGLNYGFRHGYWNAIGLQIALLIQI
FT                   MIVAAGVGVLFATTPLAFQAVKWFGVAYLLYLAYLQWRAPVKDIEIQHEKKDKSVSALL
FT                   FNGFVVNISNPKAIVFLLAVLPQFLDLSKPQWIQYLIMAATMVTIDLIVMAGYTGLASK
FT                   VLRLLRSPKQQKYLNRGFAVMFSCAALLLSTVHQAA"
     MLACWVISIS PGAGAIASMS SGLNYGFRHG YWNAIGLQIA LLIQIMIVAA GVGVLFATTP        60
     LAFQAVKWFG VAYLLYLAYL QWRAPVKDIE IQHEKKDKSV SALLFNGFVV NISNPKAIVF       120
     LLAVLPQFLD LSKPQWIQYL IMAATMVTID LIVMAGYTGL ASKVLRLLRS PKQQKYLNRG       180
     FAVMFSCAAL LLSTVHQAA                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page