(data stored in ACNUC29543 zone)

EMBL: CP000521.PE142

CP000521.PE142       Location/Qualifiers
FT   CDS             169979..170782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0146"
FT                   /product="high affinity Zn transport protein"
FT                   /note="ABC superfamily peri_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10629"
FT                   /protein_id="ABO10629.2"
FT                   /translation="MSTLGWSQGLVVSTHPIYLIAKEITKGVEEPQLLLQGQSGHDVQL
FT                   TPAHRKAINDATLVIWLGKAHEAPLNKLLSNNKKAIALLDSGILSILPQRNTRGAALPN
FT                   TVDTHVWLEPNNAVRIGFFIAALRSQQHPENKAKYWNNANTFARNMLQAAQAYDSSSNG
FT                   KPYWSYHDAYQYLERSLNLKFAGALTDDPHVAPTAAQIKYLNDSRPKAQMCLLAESFTT
FT                   KGQYQKLGSITFQPVDESMNNEDNFVTAWKKLAIKTDKCVLNTQK"
     MSTLGWSQGL VVSTHPIYLI AKEITKGVEE PQLLLQGQSG HDVQLTPAHR KAINDATLVI        60
     WLGKAHEAPL NKLLSNNKKA IALLDSGILS ILPQRNTRGA ALPNTVDTHV WLEPNNAVRI       120
     GFFIAALRSQ QHPENKAKYW NNANTFARNM LQAAQAYDSS SNGKPYWSYH DAYQYLERSL       180
     NLKFAGALTD DPHVAPTAAQ IKYLNDSRPK AQMCLLAESF TTKGQYQKLG SITFQPVDES       240
     MNNEDNFVTA WKKLAIKTDK CVLNTQK                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page