(data stored in ACNUC29543 zone)

EMBL: CP000521.PE147

CP000521.PE147       Location/Qualifiers
FT   CDS             172415..172660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0150"
FT                   /product="membrane-bound ATP synthase F0 sector, subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10633"
FT                   /db_xref="GOA:A3M139"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M139"
FT                   /protein_id="ABO10633.2"
FT                   /translation="MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELA
FT                   PQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFVG"
     MELTLGLVAI ASAILIAFGA LGTAIGFGLL GGRFLEAVAR QPELAPQLQT RMFLIAGLLD        60
     AVPMIGVGIG LFFIFANPFV G                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page