(data stored in ACNUC29543 zone)

EMBL: CP000521.PE150

CP000521.PE150       Location/Qualifiers
FT   CDS             173765..175309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0153"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10636"
FT                   /db_xref="GOA:A3M142"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M142"
FT                   /protein_id="ABO10636.2"
FT                   /translation="MQQLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGL
FT                   ADAMYGEMIEFDGGLFGMALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPEL
FT                   LGRVVDALGNPIDGKGPIDAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPVGRG
FT                   QRELIIGDRQTGKTAMAIDAIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGAMAYT
FT                   TVVAAAAADPAAMQYLAPYSGCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRP
FT                   PGREAYPGDVFYLHSRLLERASRVSAEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSA
FT                   FVPTNVISITDGQIFLETSLFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALA
FT                   QYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMA
FT                   DVEVKKIVDFDAALIAYFRSEYAPLMKQIDETGDYNKDIEAAIKAGIESFKATQTY"
     MQQLNPSEIS ALIKQRIGDL DTSATAKNEG TIVMVSDGIV RIHGLADAMY GEMIEFDGGL        60
     FGMALNLEQD SVGAVVLGNY LSLQEGQKAR CTGRVLEVPV GPELLGRVVD ALGNPIDGKG       120
     PIDAKLTDAV EKVAPGVIWR QSVDQPVQTG YKSVDTMIPV GRGQRELIIG DRQTGKTAMA       180
     IDAIIAQKNS GIKCVYVAIG QKQSTIANVV RKLEETGAMA YTTVVAAAAA DPAAMQYLAP       240
     YSGCTMGEYF RDRGEDALII YDDLSKQAVA YRQISLLLRR PPGREAYPGD VFYLHSRLLE       300
     RASRVSAEYV EKFTNGAVTG KTGSLTALPI IETQAGDVSA FVPTNVISIT DGQIFLETSL       360
     FNAGIRPAVN AGISVSRVGG SAQTKIIKKL SGGIRTALAQ YRELAAFAQF ASDLDEATRK       420
     QLEHGQRVTE LMKQKQYAPY SIADQAVSVY ASNEGYMADV EVKKIVDFDA ALIAYFRSEY       480
     APLMKQIDET GDYNKDIEAA IKAGIESFKA TQTY                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page