(data stored in ACNUC29543 zone)

EMBL: CP000521.PE152

CP000521.PE152       Location/Qualifiers
FT   CDS             176287..177681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0155"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10638"
FT                   /db_xref="GOA:A3M144"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M144"
FT                   /protein_id="ABO10638.2"
FT                   /translation="MSSGRIIQIIGAVIDVEFERTSVPKIYDALQVDGTETTLEVQQQL
FT                   GDGVVRTIAMGSTEGLKRGLTVTSTNAPISVPVGTATLGRIMDVLGRPIDEAGPVATEE
FT                   RLPIHRQAPSYAEQAASTDLLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTG
FT                   LTMAEYFRDEKDENGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMG
FT                   VLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASSGIYPAID
FT                   PLDSTSRQLDPLVVGQEHYEIARAVQNVLQRYKELKDIIAILGMDELAEEDKLVVYRAR
FT                   KIQRFFSQPFHVAEVFTGAPGKLVPLKETIRGFKGLLAGEYDHIPEQAFYMVGGIDEVI
FT                   AKAEKL"
     MSSGRIIQII GAVIDVEFER TSVPKIYDAL QVDGTETTLE VQQQLGDGVV RTIAMGSTEG        60
     LKRGLTVTST NAPISVPVGT ATLGRIMDVL GRPIDEAGPV ATEERLPIHR QAPSYAEQAA       120
     STDLLETGIK VIDLLCPFAK GGKVGLFGGA GVGKTVNMME LINNIAKAHS GLSVFAGVGE       180
     RTREGNDFYH EMKDSNVLDK VAMVYGQMNE PPGNRLRVAL TGLTMAEYFR DEKDENGKGR       240
     DVLLFVDNIY RYTLAGTEVS ALLGRMPSAV GYQPTLAEEM GVLQERITST KSGSITSIQA       300
     VYVPADDLTD PSPATTFAHL DATVVLSRDI ASSGIYPAID PLDSTSRQLD PLVVGQEHYE       360
     IARAVQNVLQ RYKELKDIIA ILGMDELAEE DKLVVYRARK IQRFFSQPFH VAEVFTGAPG       420
     KLVPLKETIR GFKGLLAGEY DHIPEQAFYM VGGIDEVIAK AEKL                        464
//

If you have problems or comments...

PBIL Back to PBIL home page