(data stored in ACNUC29543 zone)

EMBL: CP000521.PE153

CP000521.PE153       Location/Qualifiers
FT   CDS             177699..178118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0156"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   epsilon-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10639"
FT                   /db_xref="GOA:A3M145"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M145"
FT                   /protein_id="ABO10639.2"
FT                   /translation="MATMQCDVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLL
FT                   QPGPIRVLLENGTEEIVYVSGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAEQL
FT                   LANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ"
     MATMQCDVVS VKESIYSGAV TMLIAKGAGG ELGILPGHAP LVTLLQPGPI RVLLENGTEE        60
     IVYVSGGVLE VQPHVVTVLA DTAIRADNLD EAAILEARKN AEQLLANQKS DLDSAAALAA       120
     LAETAAQLET IRKIKNRAQ                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page