(data stored in ACNUC29543 zone)

EMBL: CP000521.PE16

CP000521.PE16        Location/Qualifiers
FT   CDS             complement(20391..21893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10512"
FT                   /protein_id="ABO10512.2"
FT                   /translation="MTQKNELDTKYAVIVAGGNGAGKSTLIDNVIIPKFNSLNLDINFI
FT                   NADVWQLQHFGHFDNTNPTHAREAQKWAEAERQKHLDEGRSFIAETVFSHPSKVDLIKE
FT                   AKSKGFYVVLYHIHLENSDIALDRIKDRVRKGGHDVDEDKVKARYERVLPLVAEATQYA
FT                   DLTFVLDNSVRDRPHQQVFKLEYGKITAIDNNVPDWAIKAYEKQLTDYLGLDQATKISN
FT                   TNEDLTMSNTKEKLGFEYNARLLANDIQPQHRETVVANYRKNFVEHVANSAAVAGNSHK
FT                   LDDVASLINGTTVGGHSVKDQRQVLNLIDASNELVNMVRNGNFALNKSTYLKVNGIVAD
FT                   RESIEAGVLRGEGVEQSFTPDVGIRHFRTHRPMKTEEDAPALNKFMQEGFDHINSLKNP
FT                   LEKGIATFLYGSLNQFTFEGEKRTAHLMMNGVLMSAGLDAISIPADKAIDFRQKMVRFY
FT                   ESKNADEVMEFLADLHPALNNTKKLDAEKEKKSENDFGRSFQ"
     MTQKNELDTK YAVIVAGGNG AGKSTLIDNV IIPKFNSLNL DINFINADVW QLQHFGHFDN        60
     TNPTHAREAQ KWAEAERQKH LDEGRSFIAE TVFSHPSKVD LIKEAKSKGF YVVLYHIHLE       120
     NSDIALDRIK DRVRKGGHDV DEDKVKARYE RVLPLVAEAT QYADLTFVLD NSVRDRPHQQ       180
     VFKLEYGKIT AIDNNVPDWA IKAYEKQLTD YLGLDQATKI SNTNEDLTMS NTKEKLGFEY       240
     NARLLANDIQ PQHRETVVAN YRKNFVEHVA NSAAVAGNSH KLDDVASLIN GTTVGGHSVK       300
     DQRQVLNLID ASNELVNMVR NGNFALNKST YLKVNGIVAD RESIEAGVLR GEGVEQSFTP       360
     DVGIRHFRTH RPMKTEEDAP ALNKFMQEGF DHINSLKNPL EKGIATFLYG SLNQFTFEGE       420
     KRTAHLMMNG VLMSAGLDAI SIPADKAIDF RQKMVRFYES KNADEVMEFL ADLHPALNNT       480
     KKLDAEKEKK SENDFGRSFQ                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page