(data stored in ACNUC29543 zone)

EMBL: CP000521.PE163

CP000521.PE163       Location/Qualifiers
FT   CDS             complement(185027..186178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0166"
FT                   /product="putative Rossmann-fold nucleotide-binding DNA
FT                   uptake protein (Smf)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10649"
FT                   /protein_id="ABO10649.2"
FT                   /translation="MLDVPFTMLTQLSSHHYHTLKVWYLVQHSLVSFKKIIDYFGNCEK
FT                   ATQPDGLAKWSSLGLHANHLKRVSEFQTPQGQTQFEQLVQQVVQHTDFILTPDDSGYPT
FT                   QLLPYTDHPPIIFGKGQAQALLQPQIAIVGSRKPSPHGRQVAYDFAYYLSEKGFFISSG
FT                   LAYGIDEAAHQGASAHQRTIAVTGTGLDTTYPAQNKKLAEHILAQNGAIITEFLPGTPP
FT                   LQQHFPRRNRIVSGLSLGVLVVEATLKSGSLITANKAAEQGKTVFAIPGHIYSEFHQGC
FT                   HQLIREGAILIDHPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWV
FT                   GQNIDQLVIHHNIPVSELTSSLMELELLGLCMQQSGLYLRCRS"
     MLDVPFTMLT QLSSHHYHTL KVWYLVQHSL VSFKKIIDYF GNCEKATQPD GLAKWSSLGL        60
     HANHLKRVSE FQTPQGQTQF EQLVQQVVQH TDFILTPDDS GYPTQLLPYT DHPPIIFGKG       120
     QAQALLQPQI AIVGSRKPSP HGRQVAYDFA YYLSEKGFFI SSGLAYGIDE AAHQGASAHQ       180
     RTIAVTGTGL DTTYPAQNKK LAEHILAQNG AIITEFLPGT PPLQQHFPRR NRIVSGLSLG       240
     VLVVEATLKS GSLITANKAA EQGKTVFAIP GHIYSEFHQG CHQLIREGAI LIDHPEQIIE       300
     DLALPTQWQS QQQNQTEEAN TNTPEIPEHL IDLYQSLDWV GQNIDQLVIH HNIPVSELTS       360
     SLMELELLGL CMQQSGLYLR CRS                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page