(data stored in ACNUC29543 zone)

EMBL: CP000521.PE166

CP000521.PE166       Location/Qualifiers
FT   CDS             188148..188450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10652"
FT                   /protein_id="ABO10652.1"
FT                   /translation="MLKPKAQTEAMSHAMHHSHHQHHIEQAQVPDHHDHHDANHQCQYC
FT                   TVYANLVLPPEFGVKEVLVRIQVRLVAYQQAFRHVYFALQRLFLLPQGRAPPLFA"
     MLKPKAQTEA MSHAMHHSHH QHHIEQAQVP DHHDHHDANH QCQYCTVYAN LVLPPEFGVK        60
     EVLVRIQVRL VAYQQAFRHV YFALQRLFLL PQGRAPPLFA                             100
//

If you have problems or comments...

PBIL Back to PBIL home page