(data stored in ACNUC29543 zone)

EMBL: CP000521.PE167

CP000521.PE167       Location/Qualifiers
FT   CDS             188523..190598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0170"
FT                   /product="putative outer membrane copper receptor (OprC)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10653"
FT                   /protein_id="ABO10653.2"
FT                   /translation="MPHSKFLLQPLWVAMLAVSHSGLVFAESEKNDADTNTLHSLAPIV
FT                   VTAQQGNDANGLIVHADPKQPIQPVPATDGADYLQSIMGFNSIQSGGTNGDVTFRGMFG
FT                   SRIKILTDGTENLGACPNRMDAPTSYISPESYDRISVIKGPQTVQYANTGSAATVLFER
FT                   QPEKLTSEKPYRGQASVLLGSYGRIDHNIEAAVGDEKKYIRLNANRSESNSYQDGDGNT
FT                   VPSAWKKWNADVALGFTPDENTWVEITGGKSDGESLYAGRSMDGSQFARESLGLRFEKK
FT                   NITDVIKKIEGQVNYSYNDHVMDNFRLRIPPMTHDMMTHQMVVNPSEMQVTRRTLNTRF
FT                   AMTSEWGKLNVITGIDSQQNHHAESMKSLMMDMPLTTNMKFQSYGAFGELGYQLSENSK
FT                   LVTGARLDQVKIDALKLNDDRSETLPSGFIRLETQLPEHNAKSYIGLGYVERVPDYWEL
FT                   FSTAHGNSGMPKPTFNDLDTEKTLQLDMGYQHQHGAFNSWASAYVGLINDYILMSYHNH
FT                   PTSGGHGHGSSFSAGAKNVDATIAGAEAGIGYQFTDRIQADLSAMYAWGKNTTDDKPLP
FT                   QISPLEGRLNIRYVADKYNLGLLWRAVAEQNRVSLHQGNIVGYDLKPSKGFSTLSLNGS
FT                   YNLRKDIDVSVGIDNVLDKTYTEHLNKAGSAGFGFASEEQFNNIGRNYWVRMSMKF"
     MPHSKFLLQP LWVAMLAVSH SGLVFAESEK NDADTNTLHS LAPIVVTAQQ GNDANGLIVH        60
     ADPKQPIQPV PATDGADYLQ SIMGFNSIQS GGTNGDVTFR GMFGSRIKIL TDGTENLGAC       120
     PNRMDAPTSY ISPESYDRIS VIKGPQTVQY ANTGSAATVL FERQPEKLTS EKPYRGQASV       180
     LLGSYGRIDH NIEAAVGDEK KYIRLNANRS ESNSYQDGDG NTVPSAWKKW NADVALGFTP       240
     DENTWVEITG GKSDGESLYA GRSMDGSQFA RESLGLRFEK KNITDVIKKI EGQVNYSYND       300
     HVMDNFRLRI PPMTHDMMTH QMVVNPSEMQ VTRRTLNTRF AMTSEWGKLN VITGIDSQQN       360
     HHAESMKSLM MDMPLTTNMK FQSYGAFGEL GYQLSENSKL VTGARLDQVK IDALKLNDDR       420
     SETLPSGFIR LETQLPEHNA KSYIGLGYVE RVPDYWELFS TAHGNSGMPK PTFNDLDTEK       480
     TLQLDMGYQH QHGAFNSWAS AYVGLINDYI LMSYHNHPTS GGHGHGSSFS AGAKNVDATI       540
     AGAEAGIGYQ FTDRIQADLS AMYAWGKNTT DDKPLPQISP LEGRLNIRYV ADKYNLGLLW       600
     RAVAEQNRVS LHQGNIVGYD LKPSKGFSTL SLNGSYNLRK DIDVSVGIDN VLDKTYTEHL       660
     NKAGSAGFGF ASEEQFNNIG RNYWVRMSMK F                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page