(data stored in ACNUC29543 zone)

EMBL: CP000521.PE170

CP000521.PE170       Location/Qualifiers
FT   CDS             complement(190928..192142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10655"
FT                   /protein_id="ABO10655.2"
FT                   /translation="MQMISPTRLASFNDMQDSNFFTQFLNICCEKPVQPGYTEYVSLQH
FT                   ALYEGDIEMDKVIDWVMQNPKDHRIIFEKILFQGRDELSELIPTELENFFNYIEQKPEW
FT                   LDQRQIDEAVKFTHRLGINNGFILRDLSLMAGYLYPGFNQPLILTGALKKEAGTRLAET
FT                   TKWWVDITEPQGLSRLSAGFTSTIYVRFIHALVRRQLKKSDRWDSEVWGVPLNQFDLAM
FT                   TNLAFSSVVLLGIRALGIWPTKQEAKSFLHFWRYVGWLMGIDEKWLIQSEPEGWRLLYW
FT                   MQFAHPRSDHSSVELGSSLSKEPFERKYLHLRSLQQKLAYRQHLELTQFFIGKKRMKLL
FT                   GLPQQSASWFAYYLIVRNLLLYNGAKLSPKVEKFLSKSGRNIQKLGLTLYQNQGKAKTL
FT                   ASMHQ"
     MQMISPTRLA SFNDMQDSNF FTQFLNICCE KPVQPGYTEY VSLQHALYEG DIEMDKVIDW        60
     VMQNPKDHRI IFEKILFQGR DELSELIPTE LENFFNYIEQ KPEWLDQRQI DEAVKFTHRL       120
     GINNGFILRD LSLMAGYLYP GFNQPLILTG ALKKEAGTRL AETTKWWVDI TEPQGLSRLS       180
     AGFTSTIYVR FIHALVRRQL KKSDRWDSEV WGVPLNQFDL AMTNLAFSSV VLLGIRALGI       240
     WPTKQEAKSF LHFWRYVGWL MGIDEKWLIQ SEPEGWRLLY WMQFAHPRSD HSSVELGSSL       300
     SKEPFERKYL HLRSLQQKLA YRQHLELTQF FIGKKRMKLL GLPQQSASWF AYYLIVRNLL       360
     LYNGAKLSPK VEKFLSKSGR NIQKLGLTLY QNQGKAKTLA SMHQ                        404
//

If you have problems or comments...

PBIL Back to PBIL home page