(data stored in ACNUC29543 zone)

EMBL: CP000521.PE185

CP000521.PE185       Location/Qualifiers
FT   CDS             complement(210603..211994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0188"
FT                   /product="putative transport protein (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10669"
FT                   /protein_id="ABO10669.2"
FT                   /translation="MNATPTHQALQPEYRLLVLLVSIGFFMQALDTTIVNTAIPAMAHH
FT                   LNEDPLRMHSVVVAYVLSVAACIPLSGWLADRFGVRNTFLSAIIIFTLASLGCGLSQSL
FT                   NELLFFRVIQGVGGALLLPVGRLSLLKIIPRTQFLAAMSLMSLAGLLGPLAGPTLGGWL
FT                   VEVATWHWIFLINIPMGVLGILMTLKVMPNVKEPTVKTFDLIGFVLLVVAMIGWSLGIE
FT                   HLASPEYSKWFSISLLVVGVIATLWYAYHSHTHQNALFRSRLFRNKIYAIGILGNFFAR
FT                   FGGNALPFVLPLMLQVAFGFEPFIAGLMMIPLVLGSLFSKPIVRPIIQKMGYRRFLLIN
FT                   TTLVGLCIASFAIMTVDTPTWFRALHFFLFGTLNSLQFVGMNTLTLKDLPQQDASSGNS
FT                   FLSMIMMLSMSIGVALAGTLINIFTDYYGTAHVTTAFHVTLICLGCINIITALIFWQIP
FT                   KNTPV"
     MNATPTHQAL QPEYRLLVLL VSIGFFMQAL DTTIVNTAIP AMAHHLNEDP LRMHSVVVAY        60
     VLSVAACIPL SGWLADRFGV RNTFLSAIII FTLASLGCGL SQSLNELLFF RVIQGVGGAL       120
     LLPVGRLSLL KIIPRTQFLA AMSLMSLAGL LGPLAGPTLG GWLVEVATWH WIFLINIPMG       180
     VLGILMTLKV MPNVKEPTVK TFDLIGFVLL VVAMIGWSLG IEHLASPEYS KWFSISLLVV       240
     GVIATLWYAY HSHTHQNALF RSRLFRNKIY AIGILGNFFA RFGGNALPFV LPLMLQVAFG       300
     FEPFIAGLMM IPLVLGSLFS KPIVRPIIQK MGYRRFLLIN TTLVGLCIAS FAIMTVDTPT       360
     WFRALHFFLF GTLNSLQFVG MNTLTLKDLP QQDASSGNSF LSMIMMLSMS IGVALAGTLI       420
     NIFTDYYGTA HVTTAFHVTL ICLGCINIIT ALIFWQIPKN TPV                         463
//

If you have problems or comments...

PBIL Back to PBIL home page