(data stored in ACNUC29543 zone)

EMBL: CP000521.PE188

CP000521.PE188       Location/Qualifiers
FT   CDS             214806..215273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10672"
FT                   /protein_id="ABO10672.2"
FT                   /translation="MTQQTCPCGKGSYAECCEPLHLGTTKALTAEQLMRSRYSAFALQQ
FT                   IDYIVQTTALGQQTALDKEAIAEWSKQNQWLGLEVVNANKKLDKTHAQVEFKAHYHDGK
FT                   SAQIHHEVSHFVFHQQQWFFLDPTVDMQVTMKQPCICGSGKKIKQCCAQFL"
     MTQQTCPCGK GSYAECCEPL HLGTTKALTA EQLMRSRYSA FALQQIDYIV QTTALGQQTA        60
     LDKEAIAEWS KQNQWLGLEV VNANKKLDKT HAQVEFKAHY HDGKSAQIHH EVSHFVFHQQ       120
     QWFFLDPTVD MQVTMKQPCI CGSGKKIKQC CAQFL                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page