(data stored in ACNUC29543 zone)

EMBL: CP000521.PE192

CP000521.PE192       Location/Qualifiers
FT   CDS             222248..222646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0199"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10676"
FT                   /protein_id="ABO10676.2"
FT                   /translation="MHGISSIIYIILVACLLPYAFTVIAKFTGGFQPVDNQNPRDFLAN
FT                   TKGIAARANAVQQNSFESLPLFLTAILMAEYMVVPEYFILRLGWAYIILRVIYGICYLS
FT                   NWATLRSIVWFLSLLCPIFLLIVTIKLT"
     MHGISSIIYI ILVACLLPYA FTVIAKFTGG FQPVDNQNPR DFLANTKGIA ARANAVQQNS        60
     FESLPLFLTA ILMAEYMVVP EYFILRLGWA YIILRVIYGI CYLSNWATLR SIVWFLSLLC       120
     PIFLLIVTIK LT                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page