(data stored in ACNUC29543 zone)

EMBL: CP000521.PE194

CP000521.PE194       Location/Qualifiers
FT   CDS             complement(223408..224682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0201"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10678"
FT                   /protein_id="ABO10678.1"
FT                   /translation="MLKAQKLTLAVLISAAIISSAQASEQSEAKGFVEDANGSILFRTG
FT                   YISRDKKDGRADNSSFAQTAIVNIDSGFTPGIVGFGVGVVGDGSFKIGENKNAGNNMIP
FT                   QHNDGSAYDHWARGGANVKARFSNTTVRYGTQVLDLPVLASNTARLVPEYFTGTLLTSH
FT                   EIKDLEVVAGKFTKNQYSDQIATDQNGLDRAVVWGAKYKFDDQISGSYYGVDVKDKLDR
FT                   HYVNVNYKQPLANDSSLTYDFSGYHTKFDKGANLSYATGPADEDKTNNIWAISGTYATG
FT                   PHSVMLAYQQNSGNIGYNYGVNQDGGQSVYLPNSYLSDFIGNDEKSAQIQYSLDFGKLG
FT                   VLPGLNWTTAYVYGWDIKTSNGADDSNESEFFNQVKYTVQSGFAKGSSLRLRNSIYRAD
FT                   NAYTTDYMPDTNEWRIFLDIPVTLF"
     MLKAQKLTLA VLISAAIISS AQASEQSEAK GFVEDANGSI LFRTGYISRD KKDGRADNSS        60
     FAQTAIVNID SGFTPGIVGF GVGVVGDGSF KIGENKNAGN NMIPQHNDGS AYDHWARGGA       120
     NVKARFSNTT VRYGTQVLDL PVLASNTARL VPEYFTGTLL TSHEIKDLEV VAGKFTKNQY       180
     SDQIATDQNG LDRAVVWGAK YKFDDQISGS YYGVDVKDKL DRHYVNVNYK QPLANDSSLT       240
     YDFSGYHTKF DKGANLSYAT GPADEDKTNN IWAISGTYAT GPHSVMLAYQ QNSGNIGYNY       300
     GVNQDGGQSV YLPNSYLSDF IGNDEKSAQI QYSLDFGKLG VLPGLNWTTA YVYGWDIKTS       360
     NGADDSNESE FFNQVKYTVQ SGFAKGSSLR LRNSIYRADN AYTTDYMPDT NEWRIFLDIP       420
     VTLF                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page