(data stored in ACNUC29543 zone)

EMBL: CP000521.PE197

CP000521.PE197       Location/Qualifiers
FT   CDS             complement(227371..228147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10681"
FT                   /protein_id="ABO10681.2"
FT                   /translation="MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDHG
FT                   HDAGLAGQITCRSENKETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANRFH
FT                   TWIYKEHPEVNCIIHTHPTYVAALSMLQIPLMISQMDVCALYEDCSFIGHWPGVPVGNE
FT                   EGILISSALDKNRAVLLSHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIP
FT                   HALAAEAHDWVSTDKRNKVNFAYYARKALKKHSDCI"
     MKTASVNKHD LMQHAQQDMQ KWISDLDLTD RQKLALTCRI LFDHGHDAGL AGQITCRSEN        60
     KETFITQRFG LGFDEITASN LLEVNQDLEP INQEGMANPA NRFHTWIYKE HPEVNCIIHT       120
     HPTYVAALSM LQIPLMISQM DVCALYEDCS FIGHWPGVPV GNEEGILISS ALDKNRAVLL       180
     SHHGQLVTGK TIEEACNLAL LIERAAQLQL LAMSAGQIQP IPHALAAEAH DWVSTDKRNK       240
     VNFAYYARKA LKKHSDCI                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page