(data stored in ACNUC29543 zone)

EMBL: CP000521.PE207

CP000521.PE207       Location/Qualifiers
FT   CDS             complement(238921..239772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0214"
FT                   /product="Universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10690"
FT                   /protein_id="ABO10690.2"
FT                   /translation="MSKIIACIDGSLVTNTVCDYAAWFSDKLNSPIKLLHVIDKPKAKA
FT                   PQDLSGAIGLGSRETLLKELVELEERKGKIELEHGQILLREAKNYLLEKFSIDAQSFQR
FT                   HGSVLETIMGMEDDIRVLVMGKHGNETEHDSSKIGTHIENVVRALHKPVLITSAPFSPP
FT                   KSFLIAFDGSQTARKCVERIASSPLLKGLAVHLVYVGNPNSEMQNQLSWAKEQLESQGF
FT                   NITSNTLDGEVDKAIINYAEQHQIDLIVVGAYGHSKIRQFFIGSTTTKVITSANKPVLL
FT                   LR"
     MSKIIACIDG SLVTNTVCDY AAWFSDKLNS PIKLLHVIDK PKAKAPQDLS GAIGLGSRET        60
     LLKELVELEE RKGKIELEHG QILLREAKNY LLEKFSIDAQ SFQRHGSVLE TIMGMEDDIR       120
     VLVMGKHGNE TEHDSSKIGT HIENVVRALH KPVLITSAPF SPPKSFLIAF DGSQTARKCV       180
     ERIASSPLLK GLAVHLVYVG NPNSEMQNQL SWAKEQLESQ GFNITSNTLD GEVDKAIINY       240
     AEQHQIDLIV VGAYGHSKIR QFFIGSTTTK VITSANKPVL LLR                         283
//

If you have problems or comments...

PBIL Back to PBIL home page