(data stored in ACNUC29543 zone)

EMBL: CP000521.PE210

CP000521.PE210       Location/Qualifiers
FT   CDS             complement(244369..244596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10692"
FT                   /protein_id="ABO10692.2"
FT                   /translation="MLETLLQAILEQIDEPKKDLEKNLRALLNETVEKLDLVSKQEIER
FT                   QKTALHLANQRLEALQKQVSLLEEALKNKK"
     MLETLLQAIL EQIDEPKKDL EKNLRALLNE TVEKLDLVSK QEIERQKTAL HLANQRLEAL        60
     QKQVSLLEEA LKNKK                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page