(data stored in ACNUC29543 zone)

EMBL: CP000521.PE214

CP000521.PE214       Location/Qualifiers
FT   CDS             247301..248386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10696"
FT                   /protein_id="ABO10696.2"
FT                   /translation="MSELKQDQYWMQQAIELAKRGLYSTKPNPNVGCVIVKDNQLIGEG
FT                   FHPKAGQPHAEVFALREAGEHAQGATAYVTLEPCAHYGRTPPCAEALVKAQVKKVVVAC
FT                   PDPNPLVAGKGVQILKNAGIEVEIGICEDLAAQLNQGFLKAMSTGMPYVRLKVASSLDG
FT                   RTAMASGESKWITGSAARQDVQHWRAISGAVITGIDTVIVDDCQLNVRSLHNIDIETVA
FT                   QPKRVILDRRGRLPLTAKILENPETVMVMGPYRQELADLGVIQLEIQPLKTLLQTLSKQ
FT                   YQIYDVLVEAGATLSTAFLQEGLVDEMISYVAPTLLGQSARAMFNADFEYMAQQLRFKL
FT                   LDVTQLDQDIRLRLIPTQEKV"
     MSELKQDQYW MQQAIELAKR GLYSTKPNPN VGCVIVKDNQ LIGEGFHPKA GQPHAEVFAL        60
     REAGEHAQGA TAYVTLEPCA HYGRTPPCAE ALVKAQVKKV VVACPDPNPL VAGKGVQILK       120
     NAGIEVEIGI CEDLAAQLNQ GFLKAMSTGM PYVRLKVASS LDGRTAMASG ESKWITGSAA       180
     RQDVQHWRAI SGAVITGIDT VIVDDCQLNV RSLHNIDIET VAQPKRVILD RRGRLPLTAK       240
     ILENPETVMV MGPYRQELAD LGVIQLEIQP LKTLLQTLSK QYQIYDVLVE AGATLSTAFL       300
     QEGLVDEMIS YVAPTLLGQS ARAMFNADFE YMAQQLRFKL LDVTQLDQDI RLRLIPTQEK       360
     V                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page