(data stored in ACNUC29543 zone)

EMBL: CP000521.PE225

CP000521.PE225       Location/Qualifiers
FT   CDS             complement(258501..259013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0232"
FT                   /product="type 4 fimbriae expression regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10707"
FT                   /protein_id="ABO10707.1"
FT                   /translation="MDLILPPLRERGEDVLLLANHFIQKICMEWETPSKQLTEAAKTYL
FT                   LQQHFPGNVRELRNMIERAITLSEDATIDISHLHPAPLRANISNPFVSATQNIQTTVAA
FT                   PQVVKKLPSEGLERYLENIEKDILINALNMTHWNRTLAAKKLGMTFRSLRYRLKKFGLD
FT                   TETEQEV"
     MDLILPPLRE RGEDVLLLAN HFIQKICMEW ETPSKQLTEA AKTYLLQQHF PGNVRELRNM        60
     IERAITLSED ATIDISHLHP APLRANISNP FVSATQNIQT TVAAPQVVKK LPSEGLERYL       120
     ENIEKDILIN ALNMTHWNRT LAAKKLGMTF RSLRYRLKKF GLDTETEQEV                  170
//

If you have problems or comments...

PBIL Back to PBIL home page