(data stored in ACNUC29543 zone)

EMBL: CP000521.PE230

CP000521.PE230       Location/Qualifiers
FT   CDS             262374..263420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0237"
FT                   /product="D-alanyl-D-alanine endopeptidase
FT                   penicillin-binding protein 7 and penicillin-binding protein
FT                   8"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10712"
FT                   /protein_id="ABO10712.2"
FT                   /translation="MKNSKKSLMHVLSMSILLSLSSTSFAELVNNPSSGSTGTASLNWT
FT                   AADASQLLNDEDDEPTPQGSTSVTTTLRGSNAPRVITSAPKVAPIRDTVGYNAQPSVSA
FT                   RAALVMDAQTGEVLYSKNTNASVPIASITKLMTAVVTADARLNMSEEITLEQIDFAGAG
FT                   GKNSSSTLRVGDKMNRAEVLLFALMKSENPAAAALARTYPGGRAAFVAAMNAKARALGM
FT                   NATHYYESTGLDPRNVSSARDLGILASTASQYGLIRQFSTTPTYDFNLGYRVLKSNNTN
FT                   ALVRNGGWNINLSKTGYINEAGRCVVMHTTVNSRPAVIVLLGEPSTQARNNDATNLLGW
FT                   LSNLPKRI"
     MKNSKKSLMH VLSMSILLSL SSTSFAELVN NPSSGSTGTA SLNWTAADAS QLLNDEDDEP        60
     TPQGSTSVTT TLRGSNAPRV ITSAPKVAPI RDTVGYNAQP SVSARAALVM DAQTGEVLYS       120
     KNTNASVPIA SITKLMTAVV TADARLNMSE EITLEQIDFA GAGGKNSSST LRVGDKMNRA       180
     EVLLFALMKS ENPAAAALAR TYPGGRAAFV AAMNAKARAL GMNATHYYES TGLDPRNVSS       240
     ARDLGILAST ASQYGLIRQF STTPTYDFNL GYRVLKSNNT NALVRNGGWN INLSKTGYIN       300
     EAGRCVVMHT TVNSRPAVIV LLGEPSTQAR NNDATNLLGW LSNLPKRI                    348
//

If you have problems or comments...

PBIL Back to PBIL home page