(data stored in ACNUC29543 zone)

EMBL: CP000521.PE235

CP000521.PE235       Location/Qualifiers
FT   CDS             268260..268559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0242"
FT                   /product="putative ferrous iron transport protein A"
FT                   /note="FeoA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10717"
FT                   /protein_id="ABO10717.2"
FT                   /translation="MYTSKKGLGSDAVRLSALKVKQAATITKVNRIEVESEQQDLVAIR
FT                   LESLGFVPGTRVEVITKGVFGGDPILIQIGFTRFALRKAEAEKIEIQVEEGVPA"
     MYTSKKGLGS DAVRLSALKV KQAATITKVN RIEVESEQQD LVAIRLESLG FVPGTRVEVI        60
     TKGVFGGDPI LIQIGFTRFA LRKAEAEKIE IQVEEGVPA                               99
//

If you have problems or comments...

PBIL Back to PBIL home page