(data stored in ACNUC29543 zone)

EMBL: CP000521.PE236

CP000521.PE236       Location/Qualifiers
FT   CDS             268556..270409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0243"
FT                   /product="putative ferrous iron transport protein B"
FT                   /note="FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10718"
FT                   /protein_id="ABO10718.2"
FT                   /translation="MSDALRIALVGNPNCGKTSLFNHLTGTRQKVANYAGVTVERKVGH
FT                   FQLPSGRSVRVLDLPGTYSLNATSPDEAITRDVCLGKIAEEGQQDAFLCVVDATNLKLH
FT                   LGLVLEMIELGRPILLVLNMMDEARRRGIQINTQKLSQRLGVPVVETVAVRNAGIENLL
FT                   HALDQEKYSVPQTELSGLTGTHHQKIDMIFKDVVHYVDQEDKRTDFLDRIFLHPVLGLL
FT                   SLAIMMFIVFQAVFAWAAPFMDGIEGFFGWLGEVVGSVITQPLLHSLVVDGIIAGAGGV
FT                   VVFLPQILILFFFILVLEESGYLPRAAFLLDKLMFQAGLSGRAFIPLLSSFACAVPGIM
FT                   ATRSISDPRDRFTTIMVAPLMTCSARLPVYALLIAAFIPEKMVWGIFNLQGLVLFGLYM
FT                   AGIVSALCVSFLMKFFQKDKSQHALLLELPSYRFPDLKSVGIGLLDRAKIFLKRVGGII
FT                   FALSILLWFLCTFPQPPEGATLPAIDYSFAGMLGHLIQPLFAPVGFNWQICIALIPAMA
FT                   AREVVVAALGTVYALSATDEDAVAQGLSHLISADGTGWSLATGLSLLVWFIYAPHCLAT
FT                   LATVRRETGSWKHVAAMTTYLFGLAYFASFVTYQIASHYWG"
     MSDALRIALV GNPNCGKTSL FNHLTGTRQK VANYAGVTVE RKVGHFQLPS GRSVRVLDLP        60
     GTYSLNATSP DEAITRDVCL GKIAEEGQQD AFLCVVDATN LKLHLGLVLE MIELGRPILL       120
     VLNMMDEARR RGIQINTQKL SQRLGVPVVE TVAVRNAGIE NLLHALDQEK YSVPQTELSG       180
     LTGTHHQKID MIFKDVVHYV DQEDKRTDFL DRIFLHPVLG LLSLAIMMFI VFQAVFAWAA       240
     PFMDGIEGFF GWLGEVVGSV ITQPLLHSLV VDGIIAGAGG VVVFLPQILI LFFFILVLEE       300
     SGYLPRAAFL LDKLMFQAGL SGRAFIPLLS SFACAVPGIM ATRSISDPRD RFTTIMVAPL       360
     MTCSARLPVY ALLIAAFIPE KMVWGIFNLQ GLVLFGLYMA GIVSALCVSF LMKFFQKDKS       420
     QHALLLELPS YRFPDLKSVG IGLLDRAKIF LKRVGGIIFA LSILLWFLCT FPQPPEGATL       480
     PAIDYSFAGM LGHLIQPLFA PVGFNWQICI ALIPAMAARE VVVAALGTVY ALSATDEDAV       540
     AQGLSHLISA DGTGWSLATG LSLLVWFIYA PHCLATLATV RRETGSWKHV AAMTTYLFGL       600
     AYFASFVTYQ IASHYWG                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page