(data stored in ACNUC29543 zone)

EMBL: CP000521.PE237

CP000521.PE237       Location/Qualifiers
FT   CDS             270430..270681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10719"
FT                   /protein_id="ABO10719.2"
FT                   /translation="MLQYLIIAVLVIWSAVVVFKKVFPKTANSAFSALSVFCEKQGWAT
FT                   LAKWLKPKMTFGCAGGCGCSSEDKPTNTVQEIKPVKWQ"
     MLQYLIIAVL VIWSAVVVFK KVFPKTANSA FSALSVFCEK QGWATLAKWL KPKMTFGCAG        60
     GCGCSSEDKP TNTVQEIKPV KWQ                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page