(data stored in ACNUC29543 zone)

EMBL: CP000521.PE241

CP000521.PE241       Location/Qualifiers
FT   CDS             complement(274446..274982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0248"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10723"
FT                   /protein_id="ABO10723.2"
FT                   /translation="MANDNHNQVLDEHTEVVVEGDKASAKRARKVKPKTSDVGSTASLF
FT                   GIAPYQPKKNEEYMSEGQLEHFRQILQAWKAELMSEVDRTLNTMQDESTALPDVNDRAT
FT                   QEEEFAIELRTRDRERKLIRKIEQSLEAIKNEDYGFCETCGIEIGLRRLEARPTATLCI
FT                   DCKTLAEIKEKQNNG"
     MANDNHNQVL DEHTEVVVEG DKASAKRARK VKPKTSDVGS TASLFGIAPY QPKKNEEYMS        60
     EGQLEHFRQI LQAWKAELMS EVDRTLNTMQ DESTALPDVN DRATQEEEFA IELRTRDRER       120
     KLIRKIEQSL EAIKNEDYGF CETCGIEIGL RRLEARPTAT LCIDCKTLAE IKEKQNNG         178
//

If you have problems or comments...

PBIL Back to PBIL home page